Loading...
Statistics
Advertisement

Sicher ins Mathe-Abi – 7 Tage kostenfrei testen! — MeinMatheAbi.de ...
www.mein-mathe-abi.com/

Mein-mathe-abi.com

Domain is redirected to: Meinmatheabi.de
Advertisement
Conversion Technology Metas Server
Mein-mathe-abi.com is hosted in Germany / Stuttgart . Mein-mathe-abi.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Iframe, Number of used javascripts: 2. First javascripts: Jquery-cachekey6969.js, Resourcemathepo...key7921.js, Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by Mein-mathe-abi.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Iframe
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • jquery-cachekey6969.js
  • resourcematheportal.filter.javascriptsfilterwidget-cachekey7921.js

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Mein-mathe-abi.com

Missing HTTPS protocol.

    Meta - Mein-mathe-abi.com

    Number of occurences: 2
    • Name:
      Content: IE=edge
    • Name: generator
      Content: Plone - http://plone.org

    Server / Hosting

    • IP: 94.186.148.139
    • Latitude: 48.77
    • Longitude: 9.18
    • Country: Germany
    • City: Stuttgart

    Rname

    • shades15.rzone.de
    • docks09.rzone.de
    • smtp.rzone.de

    Target

    • hostmaster.strato-rz.de

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Sat, 30 Jul 2016 14:22:03 GMT Server: nginx Content-Type: text/html Content-Length: 178 Location: https://www.meinmatheabi.de/ X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sat, 30 Jul 2016 14:22:04 GMT Content-Type: text/html;charset=utf-8 Content-Length: 20143 Connection: keep-alive Access-Control-Allow-Headers: X-Custom-Header, Authorization, x-requested-with Content-Language: de Expires: Sat, 1 Jan 2000 00:00:00 GMT Access-Control-Allow-Origin: * Access-Control-Allow-Methods: GET, POST, PUT Set-Cookie: _ZopeId="21545940A7jmvhKzpN0"; Path=/ X-Robots-Tag: all

    DNS

    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: A
    4. ip: 81.169.145.90
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: shades15.rzone.de
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: docks09.rzone.de
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: docks09.rzone.de
    5. rname: hostmaster.strato-rz.de
    6. serial: 2015030600
    7. refresh: 86400
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 7200
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: MX
    4. pri: 5
    5. target: smtp.rzone.de
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: AAAA
    4. ipv6: 2a01:238:20a:202:1090::

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ein-mathe-abi.com, www.mpein-mathe-abi.com, www.pein-mathe-abi.com, www.moein-mathe-abi.com, www.oein-mathe-abi.com, www.miein-mathe-abi.com, www.iein-mathe-abi.com, www.mkein-mathe-abi.com, www.kein-mathe-abi.com, www.m.ein-mathe-abi.com, www..ein-mathe-abi.com, www.muein-mathe-abi.com, www.uein-mathe-abi.com, www.mjein-mathe-abi.com, www.jein-mathe-abi.com, www.mnein-mathe-abi.com, www.nein-mathe-abi.com, www.m-ein-mathe-abi.com, www.-ein-mathe-abi.com, www.min-mathe-abi.com, www.mexin-mathe-abi.com, www.mxin-mathe-abi.com, www.mesin-mathe-abi.com, www.msin-mathe-abi.com, www.mewin-mathe-abi.com, www.mwin-mathe-abi.com, www.merin-mathe-abi.com, www.mrin-mathe-abi.com, www.mefin-mathe-abi.com, www.mfin-mathe-abi.com, www.mevin-mathe-abi.com, www.mvin-mathe-abi.com, www.mecin-mathe-abi.com, www.mcin-mathe-abi.com, www.meqin-mathe-abi.com, www.mqin-mathe-abi.com, www.meain-mathe-abi.com, www.main-mathe-abi.com, www.meyin-mathe-abi.com, www.myin-mathe-abi.com, www.men-mathe-abi.com, www.meirn-mathe-abi.com, www.mern-mathe-abi.com, www.meifn-mathe-abi.com, www.mefn-mathe-abi.com, www.meivn-mathe-abi.com, www.mevn-mathe-abi.com, www.meikn-mathe-abi.com, www.mekn-mathe-abi.com, www.mei,n-mathe-abi.com, www.me,n-mathe-abi.com, www.meibn-mathe-abi.com, www.mebn-mathe-abi.com, www.meign-mathe-abi.com, www.megn-mathe-abi.com, www.meitn-mathe-abi.com, www.metn-mathe-abi.com, www.meiyn-mathe-abi.com, www.meyn-mathe-abi.com, www.meiun-mathe-abi.com, www.meun-mathe-abi.com, www.meijn-mathe-abi.com, www.mejn-mathe-abi.com, www.meimn-mathe-abi.com, www.memn-mathe-abi.com, www.meinn-mathe-abi.com, www.menn-mathe-abi.com, www.mei-mathe-abi.com, www.meinn-mathe-abi.com, www.mein-mathe-abi.com, www.meinh-mathe-abi.com, www.meih-mathe-abi.com, www.meinj-mathe-abi.com, www.meij-mathe-abi.com, www.meink-mathe-abi.com, www.meik-mathe-abi.com, www.meinl-mathe-abi.com, www.meil-mathe-abi.com, www.mein -mathe-abi.com, www.mei -mathe-abi.com, www.meinmathe-abi.com, www.mein-tmathe-abi.com, www.meintmathe-abi.com, www.mein-gmathe-abi.com, www.meingmathe-abi.com, www.mein-hmathe-abi.com, www.meinhmathe-abi.com, www.mein-umathe-abi.com, www.meinumathe-abi.com, www.mein-jmathe-abi.com, www.meinjmathe-abi.com, www.mein-xmathe-abi.com, www.meinxmathe-abi.com, www.mein-smathe-abi.com, www.meinsmathe-abi.com, www.mein-amathe-abi.com, www.meinamathe-abi.com, www.mein-mathe-abi.com, www.meinmathe-abi.com, www.mein- mathe-abi.com, www.mein mathe-abi.com, www.mein-athe-abi.com, www.mein-mpathe-abi.com, www.mein-pathe-abi.com, www.mein-moathe-abi.com, www.mein-oathe-abi.com, www.mein-miathe-abi.com, www.mein-iathe-abi.com, www.mein-mkathe-abi.com, www.mein-kathe-abi.com, www.mein-m.athe-abi.com, www.mein-.athe-abi.com, www.mein-muathe-abi.com, www.mein-uathe-abi.com, www.mein-mjathe-abi.com, www.mein-jathe-abi.com, www.mein-mnathe-abi.com, www.mein-nathe-abi.com, www.mein-m-athe-abi.com, www.mein--athe-abi.com, www.mein-mthe-abi.com, www.mein-maothe-abi.com, www.mein-mothe-abi.com, www.mein-mapthe-abi.com, www.mein-mpthe-abi.com, www.mein-ma9the-abi.com, www.mein-m9the-abi.com, www.mein-mathe-abi.com, www.mein-mthe-abi.com, www.mein-maithe-abi.com, www.mein-mithe-abi.com, www.mein-mauthe-abi.com, www.mein-muthe-abi.com, www.mein-mahe-abi.com, www.mein-matqhe-abi.com, www.mein-maqhe-abi.com, www.mein-matahe-abi.com, www.mein-maahe-abi.com, www.mein-mat he-abi.com, www.mein-ma he-abi.com, www.mein-matwhe-abi.com, www.mein-mawhe-abi.com, www.mein-matehe-abi.com, www.mein-maehe-abi.com, www.mein-matzhe-abi.com, www.mein-mazhe-abi.com, www.mein-matxhe-abi.com, www.mein-maxhe-abi.com, www.mein-matche-abi.com, www.mein-mache-abi.com, www.mein-mate-abi.com, www.mein-mathee-abi.com, www.mein-matee-abi.com, www.mein-mathde-abi.com, www.mein-matde-abi.com, www.mein-mathce-abi.com, www.mein-matce-abi.com, www.mein-mathue-abi.com, www.mein-matue-abi.com, www.mein-mathje-abi.com, www.mein-matje-abi.com, www.mein-mathe-abi.com, www.mein-mate-abi.com, www.mein-mathbe-abi.com, www.mein-matbe-abi.com, www.mein-mathge-abi.com, www.mein-matge-abi.com,

    Other websites we recently analyzed

    1. Hello Maker Camp | Free workshops for makers and doers
      HelloMaker Camp is a series of hands on, free workshops on web and mobile development. We are based in San Francisco, CA
      Culver City (United States) - 205.186.183.185
      G Analytics ID: UA-57213633-1
      Server software: Apache/2.2.22
      Technology: CSS, Html, Html5, SVG, Google Analytics
      Number of Javascript: 5
      Number of meta tags: 3
    2. fr-gratuits.com
      Netherlands - 185.66.140.232
      Server software: cloudflare-nginx
      Technology: Html
      Number of meta tags: 1
    3. Soon to be the new home of: webgateway.co.za
      South Africa - 197.221.10.152
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    4. Schule für Kosmetik - Schule
      Das Ziel, eine Schule zu sein, die sich durch moderne Unterrichtsgestaltung und exklusive Fachausstattungen auszeichnet, fand im bisherigen Entwicklungsprozess seine Verwirklichung.
      Germany - 217.160.233.236
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of Javascript: 6
      Number of meta tags: 4
    5. Smart Mobile Stop
      Houston (United States) - 192.254.186.173
      Server software: nginx/1.10.1
      Technology: CSS, Html, Javascript, jQuery, jQuery UI, Php, Pingback, Wordpress
      Number of Javascript: 15
      Number of meta tags: 2
    6. What Makes You Unique? |
      Scottsdale (United States) - 184.168.235.1
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php, Pingback, Shortcodes, Swf Object, Wordpress
      Number of Javascript: 8
      Number of meta tags: 2
    7. Койко место. Рядом с метро. Хостел "Москва" в Москве, недорого
      Койко место. Хостел на ходится на Кутузовском проспекте рядом с метро. Лучшие цены в Москве
      Russian Federation - 5.101.152.141
      Server software: nginx-reuseport/1.10.0
      Technology: CSS, Html, Javascript, Yandex.Metrika
      Number of Javascript: 1
      Number of meta tags: 5
    8. 临海市优特塑料容器有限公司
      Miami (United States) - 192.157.236.25
      Server software: nginx
      Technology: CSS, Html
      Number of meta tags: 3
    9. campbeisler.com
      Scottsdale (United States) - 50.63.98.1
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    10. Сайт школы №97
      Russian Federation - 90.156.201.38
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Fancybox, Php, Yandex.Metrika, LiveInternet counter, Rambler
      Number of Javascript: 4
      Number of meta tags: 1

    Check Other Websites