Loading...
Statistics
Advertisement

Sicher ins Mathe-Abi – 7 Tage kostenfrei testen! — MeinMatheAbi.de ...
www.mein-mathe-abi.com/

Mein-mathe-abi.com

Domain is redirected to: Meinmatheabi.de
Advertisement
Conversion Technology Metas Server
Mein-mathe-abi.com is hosted in Germany / Stuttgart . Mein-mathe-abi.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Iframe, Number of used javascripts: 2. First javascripts: Jquery-cachekey6969.js, Resourcemathepo...key7921.js, Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by Mein-mathe-abi.com

Technology

Number of occurences: 5
  • CSS
  • Html
  • Iframe
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • jquery-cachekey6969.js
  • resourcematheportal.filter.javascriptsfilterwidget-cachekey7921.js

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Mein-mathe-abi.com

Missing HTTPS protocol.

    Meta - Mein-mathe-abi.com

    Number of occurences: 2
    • Name:
      Content: IE=edge
    • Name: generator
      Content: Plone - http://plone.org

    Server / Hosting

    • IP: 94.186.148.139
    • Latitude: 48.77
    • Longitude: 9.18
    • Country: Germany
    • City: Stuttgart

    Rname

    • shades15.rzone.de
    • docks09.rzone.de
    • smtp.rzone.de

    Target

    • hostmaster.strato-rz.de

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Sat, 30 Jul 2016 14:22:03 GMT Server: nginx Content-Type: text/html Content-Length: 178 Location: https://www.meinmatheabi.de/ X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sat, 30 Jul 2016 14:22:04 GMT Content-Type: text/html;charset=utf-8 Content-Length: 20143 Connection: keep-alive Access-Control-Allow-Headers: X-Custom-Header, Authorization, x-requested-with Content-Language: de Expires: Sat, 1 Jan 2000 00:00:00 GMT Access-Control-Allow-Origin: * Access-Control-Allow-Methods: GET, POST, PUT Set-Cookie: _ZopeId="21545940A7jmvhKzpN0"; Path=/ X-Robots-Tag: all

    DNS

    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: A
    4. ip: 81.169.145.90
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: shades15.rzone.de
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: NS
    4. target: docks09.rzone.de
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: docks09.rzone.de
    5. rname: hostmaster.strato-rz.de
    6. serial: 2015030600
    7. refresh: 86400
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 7200
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: MX
    4. pri: 5
    5. target: smtp.rzone.de
    host: mein-mathe-abi.com
    1. class: IN
    2. ttl: 150
    3. type: AAAA
    4. ipv6: 2a01:238:20a:202:1090::

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ein-mathe-abi.com, www.mpein-mathe-abi.com, www.pein-mathe-abi.com, www.moein-mathe-abi.com, www.oein-mathe-abi.com, www.miein-mathe-abi.com, www.iein-mathe-abi.com, www.mkein-mathe-abi.com, www.kein-mathe-abi.com, www.m.ein-mathe-abi.com, www..ein-mathe-abi.com, www.muein-mathe-abi.com, www.uein-mathe-abi.com, www.mjein-mathe-abi.com, www.jein-mathe-abi.com, www.mnein-mathe-abi.com, www.nein-mathe-abi.com, www.m-ein-mathe-abi.com, www.-ein-mathe-abi.com, www.min-mathe-abi.com, www.mexin-mathe-abi.com, www.mxin-mathe-abi.com, www.mesin-mathe-abi.com, www.msin-mathe-abi.com, www.mewin-mathe-abi.com, www.mwin-mathe-abi.com, www.merin-mathe-abi.com, www.mrin-mathe-abi.com, www.mefin-mathe-abi.com, www.mfin-mathe-abi.com, www.mevin-mathe-abi.com, www.mvin-mathe-abi.com, www.mecin-mathe-abi.com, www.mcin-mathe-abi.com, www.meqin-mathe-abi.com, www.mqin-mathe-abi.com, www.meain-mathe-abi.com, www.main-mathe-abi.com, www.meyin-mathe-abi.com, www.myin-mathe-abi.com, www.men-mathe-abi.com, www.meirn-mathe-abi.com, www.mern-mathe-abi.com, www.meifn-mathe-abi.com, www.mefn-mathe-abi.com, www.meivn-mathe-abi.com, www.mevn-mathe-abi.com, www.meikn-mathe-abi.com, www.mekn-mathe-abi.com, www.mei,n-mathe-abi.com, www.me,n-mathe-abi.com, www.meibn-mathe-abi.com, www.mebn-mathe-abi.com, www.meign-mathe-abi.com, www.megn-mathe-abi.com, www.meitn-mathe-abi.com, www.metn-mathe-abi.com, www.meiyn-mathe-abi.com, www.meyn-mathe-abi.com, www.meiun-mathe-abi.com, www.meun-mathe-abi.com, www.meijn-mathe-abi.com, www.mejn-mathe-abi.com, www.meimn-mathe-abi.com, www.memn-mathe-abi.com, www.meinn-mathe-abi.com, www.menn-mathe-abi.com, www.mei-mathe-abi.com, www.meinn-mathe-abi.com, www.mein-mathe-abi.com, www.meinh-mathe-abi.com, www.meih-mathe-abi.com, www.meinj-mathe-abi.com, www.meij-mathe-abi.com, www.meink-mathe-abi.com, www.meik-mathe-abi.com, www.meinl-mathe-abi.com, www.meil-mathe-abi.com, www.mein -mathe-abi.com, www.mei -mathe-abi.com, www.meinmathe-abi.com, www.mein-tmathe-abi.com, www.meintmathe-abi.com, www.mein-gmathe-abi.com, www.meingmathe-abi.com, www.mein-hmathe-abi.com, www.meinhmathe-abi.com, www.mein-umathe-abi.com, www.meinumathe-abi.com, www.mein-jmathe-abi.com, www.meinjmathe-abi.com, www.mein-xmathe-abi.com, www.meinxmathe-abi.com, www.mein-smathe-abi.com, www.meinsmathe-abi.com, www.mein-amathe-abi.com, www.meinamathe-abi.com, www.mein-mathe-abi.com, www.meinmathe-abi.com, www.mein- mathe-abi.com, www.mein mathe-abi.com, www.mein-athe-abi.com, www.mein-mpathe-abi.com, www.mein-pathe-abi.com, www.mein-moathe-abi.com, www.mein-oathe-abi.com, www.mein-miathe-abi.com, www.mein-iathe-abi.com, www.mein-mkathe-abi.com, www.mein-kathe-abi.com, www.mein-m.athe-abi.com, www.mein-.athe-abi.com, www.mein-muathe-abi.com, www.mein-uathe-abi.com, www.mein-mjathe-abi.com, www.mein-jathe-abi.com, www.mein-mnathe-abi.com, www.mein-nathe-abi.com, www.mein-m-athe-abi.com, www.mein--athe-abi.com, www.mein-mthe-abi.com, www.mein-maothe-abi.com, www.mein-mothe-abi.com, www.mein-mapthe-abi.com, www.mein-mpthe-abi.com, www.mein-ma9the-abi.com, www.mein-m9the-abi.com, www.mein-mathe-abi.com, www.mein-mthe-abi.com, www.mein-maithe-abi.com, www.mein-mithe-abi.com, www.mein-mauthe-abi.com, www.mein-muthe-abi.com, www.mein-mahe-abi.com, www.mein-matqhe-abi.com, www.mein-maqhe-abi.com, www.mein-matahe-abi.com, www.mein-maahe-abi.com, www.mein-mat he-abi.com, www.mein-ma he-abi.com, www.mein-matwhe-abi.com, www.mein-mawhe-abi.com, www.mein-matehe-abi.com, www.mein-maehe-abi.com, www.mein-matzhe-abi.com, www.mein-mazhe-abi.com, www.mein-matxhe-abi.com, www.mein-maxhe-abi.com, www.mein-matche-abi.com, www.mein-mache-abi.com, www.mein-mate-abi.com, www.mein-mathee-abi.com, www.mein-matee-abi.com, www.mein-mathde-abi.com, www.mein-matde-abi.com, www.mein-mathce-abi.com, www.mein-matce-abi.com, www.mein-mathue-abi.com, www.mein-matue-abi.com, www.mein-mathje-abi.com, www.mein-matje-abi.com, www.mein-mathe-abi.com, www.mein-mate-abi.com, www.mein-mathbe-abi.com, www.mein-matbe-abi.com, www.mein-mathge-abi.com, www.mein-matge-abi.com,

    Other websites we recently analyzed

    1. harmonie-sante-collectivites.eu
      Ce nom de domaine a été enregistré par Nameshield. Plus d'information à propos de ce nom de domaine sur cette page.
      Marques (France) - 81.92.80.56
      Server software: squid/3.5.12
      Technology: CSS, Html, Php
      Number of meta tags: 3
    2. ADMINISTRADOR FINCAS PALMA MALLORCA COLEGIADO 740 EN BALEARES comunidad propietarios edificio complejo administracion
      ADMINISTRADOR FINCAS PALMA MALLORCA COLEGIADO 740 EN BALEARES comunidad propietarios edificio administracion
      Spain - 164.138.208.117
      Server software: Apache
      Technology: CSS, Cufon, Html, Javascript, Php
      Number of Javascript: 6
      Number of meta tags: 3
    3. Peter's Web Site
      United Kingdom - 212.227.211.69
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
      Number of meta tags: 1
    4. citizensforcarbonval
      Ashburn (United States) - 52.6.217.246
      Server software: Pepyaka/1.9.13
      Technology: CSS, Html, Html5, Javascript, Wix
      Number of Javascript: 2
      Number of meta tags: 5
    5. priestesstarot.com
      Dublin (Ireland) - 176.34.99.149
      Server software:
      Technology: CSS, Html
    6. Le Gac Matériaux
      Le Gac Matériaux
      France - 213.186.33.5
      Server software: nginx
      Technology: Html
      Number of meta tags: 5
    7. Go Vegan Grow |
      Provo (United States) - 198.1.123.135
      G Analytics ID: UA-65180750-2
      Server software: Apache
      Technology: CSS, Cufon, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Google Analytics, Quantcast Measurement, Wordpress, Facebook Box
      Number of Javascript: 10
      Number of meta tags: 3
    8. ALASKA CUIRS ET FOURRURES | Clermont-Ferrand
      Alaska à Clermont Ferrand, cuirs et fourrures
      France - 213.186.33.3
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery UI
      Number of Javascript: 5
      Number of meta tags: 6
    9. 6888862.com
      China - 103.232.215.133
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    10. oldclove.com
      Road Town (Virgin Islands, British) - 208.91.197.241
      Server software: Apache
      Technology: Html, Javascript
      Number of meta tags: 2

    Check Other Websites